|
Technical |
Centre National
De LA Recherche scientifique (France)
CeNTRO De REGULACIO GENOMICA (
Cédric Notredame
www.tcoffee.org
T-Coffee:
Technical Documentation
T-Coffee Technical Documentation
(Version 5.70, June 2008)
www.tcoffee.org
T-Coffee
3D-Coffee
M-Coffee
R-Coffee
APDB and iRMSD
ã Cédric Notredame, Centro de Regulacio Genomica, Centre National de
la Recherche
T-Coffee is distributed under the Gnu Public License
T-Coffee code can be re-used freely
T-Coffee can be incorporated in any pipeline:
Plug-in/Plug-out…
Standard Installation of T-Coffee
Installation of APDB and iRMSD
Installation of extract_from_pdb
-in (Cf –in from the Method and Library Input section)
Structures, Sequences Methods and Library Input via the
–in Flag
Library Computation: Extension
Pair-wise Alignment Computation
Multiple Alignment Computation
Aligning more than 100 sequences with DPA
Using/finding PDB templates for the Sequences
-domain_interactive [Examples]
Conventions Regarding Filenames
Please make
sure you have agreed with the terms of the license attached to the package
before using the T-Coffee package or its documentation. T-Coffee is a freeware
open source distributed under a GPL license. This means that there is no
restriction to its use, either in an academic or a non academic environment.
Our
philosophy is that code is meant to be re-used, including ours. No permission
is needed, although we are always happy to receive pieces of improved code.
Our philosophy is to insure that as many methods as possible can be used
as plug-ins within T-Coffee. Likewise, we will give as much support as possible
to anyone wishing to turn T-Coffee into a plug-in for another method. For more
details on how to do this, see the plug-in and the plug-out sections of the
Tutorial Manual.
Again, you do not need our permission to either use T-Coffee (or your
method as a plug-in/out) but if you let us know, we will insure the stability
of T-Coffee within your system through future releases.
T-coffee is developed, maintained, monitored, used and debugged by a dedicated team that include:
Cédric Notredame
Fabrice Armougom
Des Higgins
Sebastien Moretti
Orla O’Sullivan
Eamon O’Toole
Olivier Poirot
Karsten Suhre
Vladimir Keduas
Iain Wallace
Andreas Wilm
We are
always very eager to get some user feedback. Please do not hesitate to drop us
a line at: cedric.notredame@europe.com The
latest updates of T-Coffee are always available
on: www.tcoffee.org . On this address you will also find a link to some
of the online T-Coffee servers, including Tcoffee@igs
T-Coffee can
be used to automatically check if an updated version is available, however the
program will not update automatically, as this can cause endless
reproducibility problems.
PROMPT: t_coffee –update
It is
important that you cite T-Coffee when you use it. Citing us is (almost) like
giving us money: it helps us convincing our institutions that what we do is
useful and that they should keep paying our salaries and deliver Donuts to our
offices from time to time (Not that they ever did it, but it would be nice
anyway).
Cite the
server if you used it, otherwise, cite the original paper from 2000 (No, it was
never named "T-Coffee 2000").
|
T-Coffee: A novel method for fast
and accurate multiple sequence alignment. |
|
Other useful
publications include:
|
CaspR: a web server for automated
molecular replacement using homology modelling. |
|
|
3DCoffee@igs: a web server for
combining sequences and structures into a multiple sequence alignment. |
|
|
3DCoffee: combining protein
sequences and structures within multiple sequence alignments. |
|
|
Tcoffee@igs: A web server for
computing, evaluating and combining multiple sequence alignments. |
|
|
Mocca: semi-automatic method for
domain hunting. |
|
|
T-Coffee: A novel method for fast
and accurate multiple sequence alignment. |
|
|
COFFEE: an objective function for
multiple sequence alignments. |
|
|
Mocca:
semi-automatic method for domain hunting. |
|
http://igs-server.cnrs-mrs.fr/~cnotred/Publications/Pdf/core.pp.pdf
We do not
mean to steal code, but we will always try to re-use pre-existing code whenever
that code exists, free of copyright, just like we expect people to do with our
code. However, whenever this happens, we make a point at properly citing the
source of the original contribution. If ever you recognize a piece of your code
improperly cited, please drop us a note and we will be happy to correct that.
In the mean
time, here are some important pieces of code from other packages that have been
incorporated within the T-Coffee package. These include:
-The Sim algorithm of Huang and Miller
that given two sequences computes the N best scoring local alignments.
-The tree reading/computing routines
are taken from the ClustalW Package, courtesy of Julie Thompson, Des Higgins
and Toby Gibson (Thompson, Higgins, Gibson, 1994, 4673-4680,vol. 22, Nucleic
Acid Research).
-The implementation of the algorithm
for aligning two sequences in linear space was adapted from Myers and Miller,
in CABIOS, 1988, 11-17, vol. 1)
-Various
techniques and algorithms have been implemented. Whenever relevant, the source
of the code/algorithm/idea is indicated in the corresponding function.
-64 Bits compliance was implemented by
Benjamin Sohn, Performance Computing Center Stuttgart (HLRS),
-David Mathog (Caltech) provided many
fixes and useful feedback for improving the code and making the whole soft
behaving more rationnaly
-Prof David Jones (UCL) reported and
corrected the PDB1K bug (now t_coffee/sap can align PDB sequences longer than
1000 AA).
-Johan Leckner reported several bugs
related to the treatment of PDB structures, insuring a consistent behavior
between version 1.37 and current ones.
Installation
1-decompress
distribution.tar.gz
gunzip distribution.tar.gz
2-untar
distribution.tar
tar -xvf distribution.tar
3-This
will create the distribution directory with the following structure:
distribution/bin
distribution/doc/t_coffee_doc.pdf,t_coffee_doc.html
distribution/t_coffee_source
distribution/example
distribution/html
4-go
into the main directory and type:
./install
You will
know the installation proceeded completely with the mention:
Installation of t_coffee Successful
5-When
this is done, the t_coffee executable appears as:
bin/t_coffee
You can
copy this file to the location where you store your executables (often
something like (~/bin/). Alternatively, you can also add the current location
to your path (Not recommended) using the following:
set path = ($path . <address of the t_coffee bin folder>)
Note: The latest
t_coffee distribution (2.15 and higher) is self contained and only requires one
executable. You may still require external modules (sap, blast, ClustalW) if
you wish to use another mode than the default.
Note: When
updating, make sure to remove the old distribution and any associated program
from your path.
6-If you have
PDB installed:
Assuming you
have a standard PDB installation in your file system
setenv (or export) PDB_DIR <abs path>/data/structures/all/pdb/
OR
setenv (or export) PDB_DIR <abs path>/structures/divided/pdb/
If you do
not bhave PDB installed, don't worry, t_coffee will go and fetch any structure
it needs directly from the PDB repository. It will simply be a bit slower than
if you had PDB locally.
M-Coffee is a special mode of
T-Coffee that makes it possible to combine the output of many multiple sequence
alignment packages. M-Coffee requires a standard T-Coffee installation (c.f.
previous section) and the following packages to be installed on your system:
Package Where From
==========================================================
ClustalW can interact with t_coffee
----------------------------------------------------------
Poa http://www.bioinformatics.ucla.edu/poa/
----------------------------------------------------------
Muscle http://www.drive5.com
----------------------------------------------------------
ProbCons http://probcons.stanford.edu/
----------------------------------------------------------
MAFFT http://www.biophys.kyoto-u.ac.jp/~katoh/programs/align/mafft/
----------------------------------------------------------
Dialign-T http://dialign-t.gobics.de/
----------------------------------------------------------
PCMA ftp://iole.swmed.edu/pub/PCMA/
In our hands all these packages
where very straightforward to compile and install on a standard cygwin or Linux
configuration. Just make sure you have gcc, the C compiler, properly installed.
Once the package is compiled and
ready to use, make sure that the executable is on your path, so that t_coffee
can find it automatically. Our favorite procedure is to create a bin directory
in the home. If you do so, make sure this bin is in your path and fill it with
all your executables (this is a standard Unix practice).
If you cannot, or do not want to use
a single bin directory, you can set the following environment variables to the
absolute path values of the executable you want to use. Whenever they are set,
these variables will supersede any other declaration. This is a convenient way
to experiment with multiple package versions.
POA_4_TCOOFFEE
CLUSTALW_4_TCOFFEE
POA_4_TCOFFEE
TCOFFEE_4_TCOFFEE
MAFFT_4_TCOFFEE
MUSCLE_4_TCOFFEE
DIALIGNT_4_TCOFFEE
For two of these packages, you will
need to copy some of the files in a special T-Coffee directory.
cp POA_DIR/* ~/.t_coffee/mcoffee/
cp DIALIGN-T/conf/* ~/.t_coffee/mcoffee
Note that the following files are enough for default usage:
BLOSUM.diag_prob_t10 BLOSUM75.scr blosum80_trunc.mat
dna_diag_prob_100_exp_330000 dna_diag_prob_200_exp_110000
BLOSUM.scr BLOSUM90.scr dna_diag_prob_100_exp_110000
dna_diag_prob_100_exp_550000 dna_diag_prob_250_exp_110000
BLOSUM75.diag_prob_t2 blosum80.mat dna_diag_prob_100_exp_220000
dna_diag_prob_150_exp_110000 dna_matrix.scr
If you would rather have the mcoffee directory in some other location, set the MCOFFEE_4_TCOFFEE environement variable to the propoer directory:
setenv MCOFFEE_4_TCOFFEE <directory containing mcoffee files>
APDB and iRMSD are incorporated in T-Coffee. Once t_coffee is installed, you can invoque these programs by typing:
t_coffee –other_pg apdb
t_coffee –other_pg irmsd
Seq_reformat is a reformatting package that is part of t_coffee. To use it (and see the available options), type:
t_coffee –other_pg seq_reformat
Extract_from_pdb is a PDB reformatting package that is part of t_coffee. To use it (and see the available options), type.
t_coffee –other_pg apdb –h
Extract_from_pdb requires wget in order to automatically fetch PDB structures.
In order to
make the most out of T-Coffee, you will need to install the following packages:
Package Function
===================================================
---------------------------------------------------
wget 3DCoffee
Automatic Downloading of
Structures
Remote use of the Fugue server
---------------------------------------------------
sap structure/structure comparisons
(obtain it from
---------------------------------------------------
Blast www.ncbi.nih.nlm.gov
---------------------------------------------------
Fugue protein to structure alignment
program
http://www-cryst.bioc.cam.ac.uk/fugue/download.html
Once the
package is installed, make sure make sure that the executable is on your path,
so that t_coffee can find it automatically.
Uses a
standard fugue installation and install the follwing packages:
joy,
melody, fugueali, sstruc, hbond
Copy some
data into:
cp fugue/classdef.dat /data/fugue/SUBST/classdef.dat
OR
Setenv MELODY_CLASSDEF=<location>
Setenv MELODY_SUBST=fugue/allmat.dat
All the
other configuration files must be in the right location.
R-Coffee
only requires the package
Package Function
===================================================
---------------------------------------------------
consan R-Coffee
Computes highly accurate
pairwise Alignments
NOT COMPULSORY
selab.janelia.org/software/consan/
---------------------------------------------------
RNAplfold Computes RNA secondary Structures
www.tbi.univie.ac.at/~ivo/RNA/
---------------------------------------------------
probconsRNA probcons.stanford.edu/
---------------------------------------------------
M-Coffee T-Coffee and the most common MSA
Packages
(cf M-Coffee in this
installation guide)
Follow the installation procedure, but make sure you rename the probcons executable into probconsRNA.
In order to insure a proper interface beween consan and R-Coffee, you must make sure that the file mix80.mod is in the directory ~/.t_coffee/mcoffee or in the mcoffee directory otherwise declared.
Quick Start
We only give you the very basics here. Please use the Tutorial for more detailed information on how to use our tools.
IMPORTANT: All the files mentionned here (sampe_seq...) can be found in the example directory of the distribution.
Write your
sequences in the same file (Swiss-prot, Fasta or Pir) and type.
PROMPT: t_coffee sample_seq1.fasta
This will
output two files:
sample_seq1.aln: your Multiple Sequence Alignment
sample_seq1.dnd: The Guide tree (newick Format)
IMPORTANT:
In theory nucleic acids should be automatically detected and the default methods should be adapted appropriately. However, sometimes this may fail, either because the sequences are too short or contain too many ambiguity codes.
When this happens, you are advised to explicitly set the type of your sequences
NOTE: the –special_mode=dna is not needed or supported anymore
PROMPT: t_coffee sample_dnaseq1.fasta –type=dna
M-Coffee is a
If all these packages are already
installed on your machine. You must:
1-set the following environement
variables
export POA_DIR=[absolute path of the POA installation dir]
export DIALIGNT_DIR=[Absolute path of the DIALIGN-T/conf
Once this is done, write your
sequences in a file and run: same file (Swiss-prot, Fasta or Pir) and type.
PROMPT: t_coffee sample_seq1.fasta –special_mode mcoffee
If the program starts complaining
one package or the other is missing, this means you will have to go the hard
way and install all these packages yourself... Proceed to the M-Coffee section
for more detailed instructions.
R-Coffee can be used to align RNA
sequences, using their RNApfold predicted secondary structures. The best
results are obtained by using the consan pairwise method. If you have consan
installed:
PROMPT: t_coffee sample_rnaseq1.fasta –special_mode rcoffee_consan
This will only work if your
sequences are short enough (less than 200 nucleotides). A good alternative is
the rmcoffee mode that will run Muscle, Probcons4RNA and MAfft and then use the
secondary structures predicted by RNApfold.
PROMPT: t_coffee sample_rnaseq1.fasta –special_mode mrcoffee
If you want to decide yourself which
methods should be combined by R-Coffee, run:
PROMPT: t_coffee sample_rnaseq1.fasta –special_mode rcoffee -method lalign_id_pair slow_pair
All you need is a file containing
the alignment of sequences with a known structure. These sequences must be
named according to their PDB ID, followed by the chain index ( 1aabA for
instance). All the sequences do not need to have a known structure, but at
least two need to have it.
Given the alignment:
PROMPT: t_coffee –other_pg irmsd -aln 3d_sample4.aln
Write your
sequences in the same file (Swiss-prot, Fasta or Pir) and type.
PROMPT: t_coffee –other_pg mocca sample_seq1.fasta
This command
output one files (<your
sequences>.mocca_lib) and starts an interactive menu.
Recent Modifications
Warning:
This log of recent modifications is not as thorough and accurate as it should
be.
-4.30 and
upward: the FAQ has moved into a new tutorial document
-4.30 and
upward: -in has will be deprecated and replaced by the flags:
-profile,-method,-aln,-seq,-pdb
-4.02:
-special_mode=dna is still available but not any more needed or supported. Use
type=protein or dna if you need to force things
-3.28: corrected a bug that prevents short sequences from being correctly
aligned
-Use of @ as
a separator when specifying methods parameters
-The most
notable modifications have to do with the structure of the input. From version
2.20, all files must be tagged to indicate their nature (A: alignment, S:
Sequence, L: Library…). We are becoming stricter, but that’s for your own good…
Another
important modification has to do with the flag -matrix: it now controls the
matrix being used for the computation
This
reference manual gives a list of all the flags that can be used to modify the
behavior of T-Coffee. For your convenience, we have grouped them according to
their nature. To display a list of all the flags used in the version of
T-Coffee you are using (along with their default value), type:
PROMPT: t_coffee
Or
PROMPT: t_coffee –help
Or
PROMPT:
t_coffee –help –in
Or any other
parameter
It is possible to modify T-Coffee’s behavior by setting any of the following environement variables. On the bash shell, use export VAR=”value”. On the cshell, use set $VAR=”xxx”
By default this variable is set to
$HOME/.t_coffee. This is where T-Coffee expects to find its cache, tmp dir and
possibly any temporary data stored by the program.
By default this variable is set to
$HOME/.t_coffee/tmp. This is where T-Coffee stores temporary files.
By default this variable is set to
$HOME/.t_coffee/cache. This is where T-Coffee stores any data expensive to
obtain: pdb files, sap alignments....
By default this variable is no set.
Set it if you do not want the program to generate a verbose error output file
(useful for running a server).
Indicate the location of your local
PDB installation.
Suppresses all the warnings.
You can use
any kind of separator you want (i.e. ,; <space>=). The syntax used in
this document is meant to be consistent with that of ClustalW. However, in
order to take advantage of the automatic filename compleation provided by many
shells, you can replace “=” and “,” with a space.
T-Coffee is
not POSIX compliant.
There are
many ways to enter parameters in T-Coffee, see the -parameter flag in
Parameters Priority
In general you will not need to use these complicated parameters. Yet, if you find yourself typing long command lines on a regular basis, it may be worth reading this section.
One may easily feel confused with the various manners in which the parameters can be passed to t_coffee. The reason for these many mechanisms is that they allow several levels of intervention. For instance, you may install t_coffee for all the users and decide that the defaults we provide are not the proper ones… In this case, you will need to make your own t_coffee_default file.
Later on, a user may find that he/she needs to keep re-using a specific set of parameters, different from those in t_coffee_default, hence the possibility to write an extra parameter file: parameters. In summary:
-parameters > prompt parameters > -t_coffee_defaults > -special_mode
This means that -parameters supersede all the others, while parameters provided via -special mode are the weakest.
If no flag is used <your sequence> must be the first argument. See format for further information.
PROMPT: t_coffee sample_seq1.fasta
Which is equivalent to
PROMPT: t_coffee Ssample_seq1.fasta
When you do so, sample_seq1 is used as a name prefix for every file the program outputs.
Usage:
-parameters=parameters_file
Default: no parameters file
Indicates a file containing extra parameters. Parameters read this way behave as if they had been added on the right end of the command line that they either supersede(one value parameter) or complete (list of values). For instance, the following file (parameter.file) could be used
*******sample_param_file.param********
-in=Ssample_seq1.fasta,Mfast_pair
-output=msf_aln
**************************************
Note: This is
one of the exceptions (with –infile) where the identifier tag (S,A,L,M…) can be
omitted. Any dataset provided this way will be assumed to be a sequence (S).
These exceptions have been designed to keep the program compatible with
ClustalW.
Note: This
parameter file can ONLY contain valid parameters. Comments are not allowed.
Parameters passed this way will be checked like normal parameters.
Used with:
PROMPT: t_coffee -parameters=sample_param_file.param
Will cause t_coffee to apply the fast_pair method onto to the sequences contained in sample_seq.fasta. If you wish, you can also pipe these arguments into t_coffee, by naming the parameter file "stdin" (as a rule, any file named stdin is expected to receive its content via the stdin)
cat sample_param_file.param | t_coffee -parameters=stdin
Usage:
-t_coffee_defaults=<file_name>
Default: not used.
This flag tells the program to use some default parameter file for t_coffee. The format of that file is the same as the one used with -parameters. The file used is either:
1. <file name> if a name has been specified
2. ~/.t_coffee_defaults if no file was specified
3. The file indicated by the environment variable TCOFFEE_DEFAULTS
Usage:
-special_mode= hard coded mode
Default: not used.
It indicates that t_coffee will use some hard coded parameters. These include:
quickaln: very fast approximate alignment
dali: a mode used to combine dali pairwise alignments
evaluate: defaults for evaluating an alignment
3dcoffee: runs t_coffee with the 3dcoffee parameterization
Other modes exist that are not yet fully supported
-score [Deprecated]
Usage:
-score
Default: not used
Toggles on the evaluate mode and causes t_coffee to evaluates a precomputed alignment provided via -infile=<alignment>. The flag -output must be set to an appropriate format (i.e. -output=score_ascii, score_html or score_pdf). A better default parameterization is obtained when using the flag -special_mode=evaluate.
Usage: -evaluate
Default: not used
Replaces –score. This flag toggles on the evaluate mode and causes t_coffee to evaluates a pre-computed alignment provided via -infile=<alignment>. The flag -output must be set to an appropriate format (i.e. -output=score_ascii, score_html or score_pdf).
The main purpose of –evaluate is to let you control every aspect of the evaluation. Yet it is advisable to use pre-defined parameterization: special_mode=evaluate.
PROMPT: t_coffee –infile=sample_aln1.aln -special_mode=evaluate
PROMPT: t_coffee –infile=sample_seq1.aln –in Lsample_lib1.tc_lib –special_mode=evaluate
Usage:
-convert
Default: turned off
Toggles on the conversion mode and causes T-Coffee to convert the sequences, alignments, libraries or structures provided via the -infile and -in flags. The output format must be set via the -output flag. This flag can also be used if you simply want to compute a library (i.e. you have an alignment and you want to turn it into a library).
This flag is ClustalW compliant.
Usage: -do_align
Default: turned on
Usage:
-version
Default: not used
Returns the current version number
Usage:
-check_configuration
Default: not used
Checks your system to determine whether all the programs T-Coffee can interact with are installed.
Usage:
-cache=<use, update, ignore, <filename>>
Default: -cache=use
By default, t_coffee stores in a cache directory, the results of computationally expensive (structural alignment) or network intensive (BLAST search) operations.
Usage:
-update
Default: turned off
Causes a wget access that checks whether the t_coffee version you are using needs updating.
Usage:
-full_log=<filename>
Default: turned off
Causes t_coffee to output a full log file that contains all the input/output files.
Usage:
-other_pg=<filename>
Default: turned off
Some rumours claim that Tetris is embedded within T-Coffee and could be ran using some special set of commands. We wish to deny these rumours, although we may admit that several interesting reformatting programs are now embedded in t_coffee and can be ran through the –other_pg flag.
PROMPT: t_coffee –other_pg=seq_reformat
PROMPT: t_coffee –other_pg=unpack_all
PROMPT: t_coffee –other_pg=unpack_extract_from_pdb
To remain compatible with ClustalW, it is possible to indicate the sequences with this flag
PROMPT: t_coffee -infile=sample_seq1.fasta
Note: Common
multiple sequence alignments format constitute a valid input format.
Note: T-Coffee
automatically removes the gaps before doing the alignment. This behaviour is
different from that of ClustalW where the gaps are kept.
-in (Cf –in from the Method and Library Input section)
Usage:
-get_type
Default: turned off
Forces t_coffee to identify the sequences type (PROTEIN, DNA).
Usage:
-type=DNA ¦ PROTEIN¦ DNA_PROTEIN
Default: -type=<automatically set>
This flag sets the type of the sequences. If omitted, the type is guessed automatically. This flag is compatible with ClustalW.
Usage:
-seq=[<P,S><name>,]
Default: none
-seq is now
the recommended flag to provide your sequences. It behaves mostly like the -in
flag.
Usage:
-seq_source=<ANY or _LS or LS >
Default: ANY.
You may not want to combine all the provided sequences into a single sequence list. You can do by specifying that you do not want to treat all the –in files as potential sequence sources.
-seq_source=_LA indicates that neither sequences provided via the A (Alignment) flag or via the L (Library flag) should be added to the sequence list.
-seq_source=S means that only sequences provided via the S tag will be considered. All the other sequences will be ignored.
Note: This flag is mostly designed for interactions
between T-Coffee and T-CoffeeDPA (the large scale version of T-Coffee).
Usage: -pdb=<pdbid1>,<pdbid2>…[Max 200]
Default: None
Reads or fetch a pdb file. It is possible to specify a chain or even a sub-chain:
PDBID(PDB_CHAIN)[opt] (FIRST,LAST)[opt]
It is also possible to input structures via the –in flag. In that case, you will need to use the TAG identifier:
-in Ppdb1 Ppdb2…
Usage:
-usetree=<tree file>
Default: No file specified
Format: newick tree format (ClustalW Style)
This flag indicates that rather than computing a new dendrogram, t_coffee must use a pre-computed one. The tree files are in phylips format and compatible with ClustalW. In most cases, using a pre-computed tree will halve the computation time required by t_coffee. It is also possible to use trees output by ClustalW, Phylips and any other program.
The -in Flag and
its Identifier TAGS
<-in> is the real grinder of T-Coffee. Sequences, methods and alignments all pass through so that T-Coffee can turn it all into a single list of constraints (the library). Everything is done automatically with T-Coffee going through each file to extract the sequences it contains. The methods are then applied to the sequences. Pre-compiled constraint list can also be provided. Each file provided via this flag must be preceded with a symbol (Identifier TAG) that indicates its nature to T-Coffee. The TAGs currently supported are the following:
P PDB structure
S for sequences (use it as well to treat an MSA as unaligned sequences)
M Methods used to build the library
L Pre-computed T-Coffee library
A Multiple Alignments that must be turned into a Library
X Substitution matrices.
R Profiles. This is a legal multiple alignments that will be treated as single sequences (the sequences it contains will not be realigned).
If you do not want to use the TAGS, you will need to use the following flags in replacement of -in. Do not use the TAGS when using these flags:
-aln Alignments (A)
-profile Profiles (R)
-method Method (M)
-seq Sequences (S)
-in
Usage:
-in=[<P,S,A,L,M,X><name>,]
Default: -in=Mlalign_id_pair,Mclustalw_pair
Note: -in can be replaced with the combined usage of -aln, iprofile, .pdb, .lib, -method.
See the box for an explanation of the -in flag. The following argument passed via -in
PROMPT: t_coffee -in=Ssample_seq1.fasta,Asample_aln1.aln,Asample_aln2.msf,Mlalign_id_pair,Lsample_lib1.tc_lib –outfile=outaln
This command will trigger the following chain of events:
1-Gather all the sequences
Sequences within all the provided files are pooled together. Format recognition is automatic. Duplicates are removed (if they have the same name). Duplicates in a single file are only tolerated in FASTA format file, although they will cause sequences to be renamed.
In the above case, the total set of sequences will be made of sequences contained in sequences1.seq, alignment1.aln, alignment2.msf and library.lib, plus the sequences initially gathered by -infile.
2-Turn alignments into libraries
alignment1.aln and alignment2.msf will be read and turned into libraries. Another library will be produced by applying the method lalign_id_pair to the set of sequences previously obtained (1). The final library used for the alignment will be the combination of all this information.
Note as well the following rules:
1-Order: The order in which sequences, methods, alignments and libraries are fed in is irrelevant.
2-Heterogeneity: There is no need for each element (A, S, L) to contain the same sequences.
3-No Duplicate: Each file should contain only one copy of each sequence. Duplicates are only allowed in FASTA files but will cause the sequences to be renamed.
4-Reconciliation: If two files (for instance two alignments) contain different versions of the same sequence due to an indel, a new sequence will be reconstructed and used instead:
aln 1:hgab1 AAAAABAAAAA
aln 2:hgab1 AAAAAAAAAACCC
will cause the program to reconstruct and use the following sequence
hgab1 AAAAABAAAAACCC
This can be useful if you are trying to combine several runs of blast, or structural information where residues may have been deleted. However substitutions are forbidden. If two sequences with the same name cannot be merged, they will cause the program to exit with an information message.
5-Methods: The method describer can either be built in (See ### for a list of all the available methods) or be a file describing the method to be used. The exact syntax is provided in part 4 of this manual.
6-Substitution Matrices: If the method is a substitution matrix (X) then no other type of information should be provided. For instance:
PROMPT: t_coffee sample_seq1.fasta -in=Xpam250mt -gapopen=-10 -gapext=-1
This command results in a progressive alignment carried out on the sequences in seqfile. The procedure does not use any more the T-Coffee concistency based algorithm, but switches to a standard progressive alignment algorithm (like ClustalW or Pileup) much less accurate. In this context, appropriate gap penalties should be provided. The matrices are in the file source/matrices.h. Add-Hoc matrices can also be provided by the user (see the matrices format section at the end of this manual).
Warning: Xmatrix does not have the same effect as using the -matrix flag. The -matrix defines the matrix that will be used while compiling the library while the Xmatrix defines the matrix used when assembling the final alignment.
Usage:
-profile=[<name>,] maximum of 200 profiles.
Default: no default
This flag causes T-Coffee to treat multiple alignments as a single sequences, thus making it possible to make multiple profile alignments. The profile-profile alignment is controlled by -profile_mode and -profile_comparison. When provided with the -in flag, profiles must be preceded with the letter R.
PROMPT: t_coffee –profile sample_aln1.aln,sample_aln2.aln –outfile=profile_aln
PROMPT: t_coffee –in Rsample_aln1.aln,Rsample_aln2.aln,Mslow_pair,Mlalign_id_pair –outfile=profile_aln
Note that when using –template_file, the program will also look for the templates associated with the profiles, even if the profiles have been provided as templates themselves (however it will not look for the template of the profile templates of the profile templates…)
Usage:
-profile1=[<name>], one name only
Default: no default
Similar to the previous one and was provided for compatibility with ClustalW.
Usage:
-profile1=[<name>], one name only
Default: no default
Similar to the previous one and was provided for compatibility with ClustalW.
Usage:
-lalign_n_top=<Integer>
Default: -lalign_n_top=10
Number of alignment reported by the local method (lalign).
Unsuported
-lib_list [Unsupported]
Usage:
-lib_list=<filename>
Default:unset
Use this flag if you do not want the library computation to take into account all the possible pairs in your dataset. For instance
Format:
2
Name1 name2
2
Name1 name4
3
Name1 Name2 Name3…
(the line 3 would be used by a multiple alignment method).
Usage:
-do_normalise=<0 or a positive value>
Default:-do_normalise=1000
Development Only
When using a value different from 0, this flag sets the score of the highest scoring pair to 1000.
Usage: -extend=<0,1 or a positive value>
Default:-extend=1
Development Only
When turned on, this flag indicates that the library extension should be carried out when performing the multiple alignment. If -extend =0, the extension is not made, if it is set to 1, the extension is made on all the pairs in the library. If the extension is set to another positive value, the extension is only carried out on pairs having a weight value superior to the specified limit.
Usage: -extend=<string>
Default:-extend=very_fast_triplet
Warning: Development Only
Controls the algorithm for matrix extension. Available modes include:
relative_triplet Unsupported
g_coffee Unsupported
g_coffee_quadruplets Unsupported
fast_triplet Fast triplet extension
very_fast_triplet slow triplet extension, limited to the -max_n_pair best sequence pairs when aligning two profiles
slow_triplet Exhaustive use of all the triplets
mixt Unsupported
quadruplet Unsupported
test Unsupported
matrix Use of the matrix -matrix
fast_matrix Use of the matrix -matrix. Profiles are turned into consensus
Usage: -max_n_pair=<integer>
Default:-extend=10
Development Only
Controls the number of pairs considered by the -extend_mode=very_fast_triplet. Setting it to 0 forces all the pairs to be considered (equivalent to -extend_mode=slow_triplet).
Usage: Unsupported
Usage: Unsupported
Usage: Unsupported
Usage: Unsupported
Usage: Flag -do_self
Default: No
This flag causes the extension to carried out within the sequences (as opposed to between sequences). This is necessary when looking for internal repeats with Mocca.
Usage: Unsupported
Usage: -weight=<winsimN, sim or
sim_<matrix_name or matrix_file> or <integer value>
Default: -weight=sim
Weight defines the way alignments are weighted when turned into a library. Overweighting can be obtained with the OW<X> weight mode.
winsimN indicates that the weight assigned to a given pair will be equal to the percent identity within a window of 2N+1 length centered on that pair. For instance winsim10 defines a window of 10 residues around the pair being considered. This gives its own weight to each residue in the output library. In our hands, this type of weighting scheme has not provided any significant improvement over the standard sim value.
PROMPT: t_coffee sample_seq1.fasta -weight=winsim10 –out_lib=test.tc_lib
sim indicates that the weight equals the average identity within the sequences containing the matched residues.
OW<X> Will
cause the sim weight to be multiplied by X
sim_matrix_name indicates the average identity with two residues regarded as identical when their substitution value is positive. The valid matrices names are in matrices.h (pam250mt) .Matrices not found in this header are considered to be filenames. See the format section for matrices. For instance, -weight=sim_pam250mt indicates that the grouping used for similarity will be the set of classes with positive substitutions.
PROMPT: t_coffee sample_seq1.fasta -weight=winsim10 –out_lib=test.tc_lib
Other groups include
sim_clustalw_col ( categories of clustalw marked with :)
sim_clustalw_dot ( categories of clustalw marked with .)
Value indicates that all the pairs found in the alignments must be given the same weight equal to value. This is useful when the alignment one wishes to turn into a library must be given a pre-specified score (for instance if they come from a structure super-imposition program). Value is an integer:
PROMPT: t_coffee sample_seq1.fasta -weight=1000 –out_lib=test.tc_lib
-distance_matrix_mode
Usage:
-distance_matrix_mode=<slow, fast, very_fast>
Default: very_fast
This flag indicates the method used for computing the distance matrix (distance between every pair of sequences) required for the computation of the dendrogram.
Slow The chosen dp_mode using the extended library,
fast: The fasta dp_mode using the extended library.
very_fast The fasta dp_mode using blosum62mt.
ktup Ktup matching (Muscle kind)
aln Read the distances on a precomputed MSA
Usage:
-quicktree
Description: Causes T-Coffee to compute a fast approximate guide tree
This flag is
kept for compatibility with ClustalW. It indicates that:
PROMPT: t_coffee sample_seq1.fasta –distance_matrix_mode=very_fast
PROMPT: t_coffee sample_seq1.fasta –quicktree
Controlling Alignment Computation
Most parameters in this section refer to the alignment mode fasta_pair_wise and cfatsa_pair_wise. When using these alignment modes, things proceed as follow:
1-Sequences are recoded using a degenerated alphabet provided with <-sim_matrix>
2-Recoded sequences are then hashed into ktuples of size <-ktup>
3-Dynamic programming runs on the <-ndiag> best diagonals whose score is higher than <-diag_threshold>, the way diagonals are scored is controlled via <-diag_mode> .
4-The Dynamic computation is made to optimize either the library scoring scheme (as defined by the -in flag) or a substitution matrix as provided via the -matrix flag. The penalty scheme is defined by -gapopen and -gapext. If -gapopen is undefined, the value defined in -cosmetic_penalty is used instead.
5-Terminal gaps are scored according to -tg_mode
Usage: -dp_mode=<string>
Default: -dp_mode=cfasta_fair_wise
This flag indicates the type of dynamic programming used by the program:
PROMPT: t_coffee sample_seq1.fasta –dp_mode myers_miller_pair_wise
gotoh_pair_wise: implementation of the gotoh algorithm (quadratic in memory and time)
myers_miller_pair_wise:
implementation of the Myers and Miller dynamic programming algorithm (
quadratic in time and linear in space). This algorithm is recommended for very
long sequences. It is about 2 times slower than gotoh and only accepts tg_mode=1or 2 (i.e. gaps penalized for
opening).
fasta_pair_wise: implementation of the fasta algorithm.
The sequence is hashed, looking for ktuples
words. Dynamic programming is only carried out on the ndiag best scoring diagonals. This is much faster but less accurate
than the two previous. This mode is controlled by the parameters -ktuple,
-diag_mode and -ndiag
cfasta_pair_wise: c stands for
checked. It is the same algorithm. The dynamic programming is made on the ndiag best diagonals, and then on the
2*ndiags, and so on until the scores converge. Complexity will depend on the
level of divergence of the sequences, but will usually be L*log(L), with an
accuracy comparable to the two first mode ( this was checked on BaliBase). This
mode is controlled by the parameters -ktuple, -diag_mode and –ndiag
Note: Users may
find by looking into the code that other modes with fancy names exists
(viterby_pair_wise…) Unless mentioned in this documentation, these modes are
not supported.
Usage: -ktuple=<value>
Default: -ktuple=1 or 2
Indicates the ktuple size for cfasta_pair_wise dp_mode and fasta_pair_wise. It is set to 1 for proteins, and 2 for DNA. The alphabet used for protein can be a degenerated version, set with -sim_matrix..
Usage: -ndiag=<value>
Default: -ndiag=0
Indicates the number of diagonals used by the fasta_pair_wise algorithm (cf -dp_mode). When -ndiag=0, n_diag=Log (length of the smallest sequence)+1.
When –ndiag and
–diag_threshold are set, diagonals are selected if and only if they fulfill
both conditions.
Usage: -diag_mode=<value>
Default: -diag_mode=0
Indicates the manner in which diagonals are scored during the fasta hashing.
0: indicates that the score of a diagonal is equal to the sum of the scores of the exact matches it contains.
1 indicates that this score is set equal to the score of the best uninterrupted segment (useful when dealing with fragments of sequences).
Usage: -diag_threshold=<value>
Default: -diag_threshold=0
Sets the value of the threshold when selecting diagonals.
0: indicates that –ndiag should be used to select the diagonals (cf –ndiag section).
Usage: -sim_matrix=<string>
Default: -sim_matrix=vasiliky
Indicates the manner in which the amino acid alphabet is degenerated when hashing in the fasta_pairwise dynamic programming. Standard ClustalW matrices are all valid. They are used to define groups of amino acids having positive substitution values. In T-Coffee, the default is a 13 letter grouping named Vasiliky, with residues grouped as follows:
rk, de, qh, vilm, fy (other residues kept alone).
This alphabet is set with the flag -sim_matrix=vasiliky. In order to keep the alphabet non degenerated, -sim_matrix=idmat can be used to retain the standard alphabet.
Usage: -matrix=<blosum62mt>
Default: -matrix=blosum62mt
The usage of this flag has been modified from previous versions, due to frequent mistakes in its usage. This flag sets the matrix that will be used by alignment methods within t_coffee (slow_pair, lalign_id_pair). It does not affect external methods (like clustal_pair, clustal_aln…).
Users can also provide their own matrices, using the matrix format described in the appendix.
Usage: -nomatch=<positive value>
Default: -nomatch=0
Indicates the penalty to associate with a match. When using a library, all matches are positive or equal to 0. Matches equal to 0 are unsupported by the library but non-penalized. Setting nomatch to a non-negative value makes it possible to penalize these null matches and prevent unrelated sequences from being aligned (this can be useful when the alignments are meant to be used for structural modeling).
Usage: -gapopen=<negative value>
Default: -gapopen=0
Indicates the penalty applied for opening a gap. The penalty must be negative. If no value is provided when using a substitution matrix, a value will be automatically computed.
Here are some guidelines regarding the tuning of gapopen and gapext. In T-Coffee matches get a score between 0 (match) and 1000 (match perfectly consistent with the library). The default cosmetic penalty is set to -50 (5% of a perfect match). If you want to tune -gapoen and see a strong effect, you should therefore consider values between 0 and -1000.
Usage: -gapext=<negative value>
Default: -gapext=0
Indicates the penalty applied for extending a gap (cf -gapopen)
Unsupported
Unsupported
Usage: -cosmetic_penalty=<negative value>
Default: -cosmetic_penalty=-50
Indicates the penalty applied for opening a gap. This penalty is set to a very low value. It will only have an influence on the portions of the alignment that are unalignable. It will not make them more correct, but only more pleasing to the eye ( i.e. Avoid stretches of lonely residues).
The cosmetic penalty is automatically turned off if a substitution matrix is used rather than a library.
Usage: -tg_mode=<0, 1, or 2>
Default: -tg_mode=1
0: terminal gaps penalized with -gapopen + -gapext*len
1: terminal gaps penalized with a -gapext*len
2: terminal gaps unpenalized.
Usage:
-seq_weight=<t_coffee or <file_name>>
Default: -seq_weight=t_coffee
These are the individual weights assigned to each sequence. The t_coffee weights try to compensate the bias in consistency caused by redundancy in the sequences.
sim(A,B)=%similarity between A and B, between 0 and 1.
weight(A)=1/sum(sim(A,X)^3)
Weights are normalized so that their sum equals the number of sequences. They are applied onto the primary library in the following manner:
res_score(Ax,By)=Min(weight(A), weight(B))*res_score(Ax, By)
These are very simple weights. Their main goal is to prevent a single sequence present in many copies to dominate the alignment.
Note: The
library output by -out_lib is the un-weighted
library.
Note: Weights
can be output using the -outseqweight flag.
Note: You can
use your own weights (see the format section).
Usage:
-msa_mode=<tree,graph,precomputed>
Default: -evaluate_mode=tree
Unsupported
Usage: -one2all=<name>
Default: not used
Will generate a one to all library with respect to the specified sequence and will then align all the sequences in turn to that sequence, in a sequence determined by the order in which the sequences were provided.
–profile_comparison =profile, the MSAs provided via –profile are vectorized and the function specified by –profile_comparison is used to make profile profile alignments. In that case, the complexity is NL^2
-profile_comparison
Usage:
-profile_mode=<fullN,profile>
Default: -profile_mode=full50
The profile mode flag controls the multiple profile alignments in T-Coffee. There are two instances where t_coffee can make multiple profile alignments:
1-When N, the number of sequences is higher than –maxnseq, the program switches to its multiple profile alignment mode (t_coffee_dpa).
2-When MSAs are provided via the –profile flag or via –profile1 and –profile2.
In these situations, the –profile_mode value influences the alignment computation, these values are:
–profile_comparison =profile, the MSAs provided via –profile are vectorized and the function specified by –profile_comparison is used to make profile profile alignments. In that case, the complexity is NL^2
-profile_comparison=fullN, N is an integer value that can omitted. Full indicates that given two profiles, the alignment will be based on a library that includes every possible pair of sequences between the two profiles. If N is set, then the library will be restricted to the N most similar pairs of sequences between the two profiles, as judged from a measure made on a pairwise alignment of these two profiles.
-profile_mode
Usage:
-profile_mode=<cw_profile_profile, muscle_profile_profile, multi_channel>
Default: -profile_mode=cw_profile_profile
When –profile_comparison=profile, this flag selects a profile scoring function.
Usage: -clean_aln
Default:-clean_aln
This flag causes T-Coffee to post-process the multiple alignment. Residues that have a reliability score smaller or equal to -clean_threshold (as given by an evaluation that uses -clean_evaluate_mode) are realigned to the rest of the alignment. Residues with a score higher than the threshold constitute a rigid framework that cannot be altered.
The cleaning algorithm is greedy. It starts from the top left segment of low constituency residues and works its way left to right, top to bottom along the alignment. You can require this operation to be carried out for several cycles using the -clean_iterations flag.
The rationale behind this operation is mostly cosmetic. In order to ensure a decent looking alignment, the gop is set to -20 and the gep to -1. There is no penalty for terminal gaps, and the matrix is blosum62mt.
Note: Gaps are
always considered to have a reliability score of 0.
Note: The use of the
cleaning option can result in memory overflow when aligning large sequences,
Usage: -clean_threshold=<0-9>
Default:-clean_aln=1
See
-clean_aln for details.
Usage: -clean_iteration=<value between 1 and
>
Default:-clean_iteration=1
See
-clean_aln for details.
Usage: -clean_iteration=<evaluation_mode
>
Default:-clean_iteration=t_coffee_non_extended
Indicates the mode used for the evaluation that will indicate the segments that should be realigned. See -evaluation_mode for the list of accepted modes.
Usage:
-iterate=<integer>
Default: -iterate=0
Sequences are extracted in turn and realigned to the MSA. If iterate is set to -1, each sequence is realigned, otherwise the number of iterations is set by –iterate.
Usage: -multi_thread=<N>
Default: 0
Specifies that the program should be used in multithreading mode. N specifies the number of processors available.
PROMPT: t_coffee sample_seq2.fasta -multi_thread 4
If you are using a quadriprocessor
Usage: deprecated
Usage: -ulimit=<value>
Default: -ulimit=0
Specifies the upper limit of memory usage (in Megabytes). Processes exceeding this limit will automatically exit. A value 0 indicates that no limit applies.
Usage: -maxlen=<value, 0=nolimit>
Default: -maxlen=1000
Indicates the maximum length of the sequences.
Usage: -maxnseq=<value, 0=nolimit>
Default: -maxnseq=50
Indicates the maximum number of sequences before triggering the use of t_coffee_dpa.
Usage:
-dpa_master_aln=<File, method>
Default: -dpa_master_aln=NO
When using dpa, t_coffee needs a seed alignment that can be computed using any appropriate method. By default, t_coffee computes a fast approximate alignment.
A pre-alignment can be provided through this flag, as well as any program using the following syntax:
your_script –in <fasta_file> -out <file_name>
Usage:
-dpa_maxnseq=<integer value>
Default: -dpa_maxnseq=30
Maximum number of sequences aligned simultaneously when DPA is ran. Given the tree computed from the master alignment, a node is sent to computation if it controls more than –dpa_maxnseq OR if it controls a pair of sequences having less than –dpa_min_score2 percent ID.
Usage:
-dpa_min_score1=<integer value>
Default: -dpa_min_score1=95
Threshold for not realigning the sequences within the master alignment. Given this alignment and the associated tree, sequences below a node are not realigned if none of them has less than –dpa_min_score1 % identity.
Usage:
-dpa_min_score2
Default: -dpa_min_score2
Maximum number of sequences aligned simultaneously when DPA is ran. Given the tree computed from the master alignment, a node is sent to computation if it controls more than –dpa_maxnseq OR if it controls a pair of sequences having less than –dpa_min_score2 percent ID.
Usage: -dpa_tree=<filename>
Default: -unset
Guide tree used in DPA. This is a newick tree where the distance associated with each node is set to the minimum pairwise distance among all considered sequences.
Usage:
-special_mode=3dcoffee
Default: turned off
Runs t_coffee with the 3dcoffee mode (cf next section).
Usage:
-check_pdb_status
Default: turned off
Forces t_coffee to run extract_from_pdb to check the pdb status of each sequence. This can considerably slow down the program.
It is possible to use t_coffee to compute multiple structural alignments. To do so, ensure that you have the sap program installed.
PROMPT: t_coffee –pdb=struc1.pdb,struc2.pdb,struc3.pdb -method sap_pair
Will combine the pairwise alignments produced by SAP. There are currently two methods that can be interfaced with t_coffee:
sap_pair: that uses the sap algorithm
align_pdb: uses a t_coffee implementation of sap, not as accurate.
When providing a PDB file, the computation is only carried out on the first chain of this file. If your original file contains several chain, you should extract the chain you want to work on. You can use t_coffee –other_pg extract_from_pdb or any pdb handling program.
If you are working with public PDB files, you can use the PDB identifier and specify the chain by adding its index to the identifier (i.e. 1pdbC). If your structure is an NMR structure, you are advised to provide the program with one structure only.
If you wish to align only a portion of the structure, you should extract it yourself from the pdb file, using t_coffee –other_pg extract_from_pdb or any pdb handling program.
You can provide t_coffee with a mixture of sequences and structure. In this case, you should use the special mode:
PROMPT: t_coffee –special_mode 3dcoffee –seq 3d_sample3.fasta -template_file template_file.template
Usage:
-template_file =
<filename,
SCRIPT_scriptame,
SELF_TAG
SEQFILE_TAG_filename,
no>
Default: no
This flag instructs t_coffee on the templates that will be used when combining several types of information. For instance, when using structural information, this file will indicate the structural template that corresponds to your sequences. The identifier T indicates that the file should be a FASTA like file, formatted as follows. There are several ways to pass the templates:
1-File name
This file contains the sequence/template association it uses a FASTA-like format, as follows:
><sequence
name> _P_ <pdb template>
><sequence
name> _G_ <gene template>
><sequence
name> _R_ <MSA template>
><sequence
name> _F_ <RNA Secondary Structure>
Each template will be used in place of the sequence with the appropriate method. For instance, structural templates will be aligned with sap_pair and the information thus generated will be transferred onto the alignment.
Note the following rule:
-Each sequence can have one template of each type (structural, genomics…)
-Each sequence can only have one template of a given type
-Several sequences can share the same template
-All the sequences do not need to have a template
The type of template on which a method works is declared with the SEQ_TYPE parameter in the method configuration file:
SEQ_TYPE S: a method that uses sequences
SEQ_TYPE PS: a pairwise method that aligns sequences and structures
SEQ_TYPE P: a method that aligns structures (sap for instance)
There are 4 tags identifying the template type:
_P_ Structural templates: a pdb identifier OR a pdb file
_G_ Genomic templates: a protein sequence where boundary amino-acid have been recoded with ( o:0, i:1, j:2)
_R_ Profile Templates: a file containing a multiple sequence alignment
_F_ RNA secondary Structures
More than one template file can be provided. There is no need to have one template for every sequence in the dataset.
_P_, _G_,
and _R_ are known as template TAGS
2-SCRIPT_<scriptname>
Indicates that filename is a script that will be used to generate a valid template file. The script will run on a file containing all your sequences using the following syntax:
scriptname –infile=<your sequences> -outfile=<template_file>
It is also possible to pass some parameters, use @ as a separator and # in place of the = sign. For instance, if you want to call the a script named blast.pl with the foloowing parameters;
blast.pl -db=pdb -dir=/local/test
Use
SCRIPT_blast.pl@db#pdb@dir#/local/test
Bear in mind that the input output flags will then be concatenated to this command line so that t_coffee ends up calling the program using the following system call:
blast.pl -db=pdb -dir=/local/test -infile=<some tmp file> -outfile=<another tmp file>
3-SELF_TAG
TAG can take the value of any of the known TAGS (_S_, _G_, _P_). SELF indicates that the original name of the sequence will be used to fetch the template:
PROMPT: t_coffee 3d_sample2.fasta –template_file SELF_P_
The previous command will work because the sequences in 3d_sample3 are named
4-SEQFILE_TAG_filename
Use this flag if your templates are in filename, and are named according to the sequences. For instance, if your protein sequences have been recoded with Exon/Intron information, you should have the recoded sequences names according to the original:
SEQFILE_G_recodedprotein.fasta
Usage:
-struc_to_use=<struc1, struc2…>
Default: -struc_to_use=NULL
Restricts the 3Dcoffee to a set of pre-defined structures.
It is
possible to compute multiple local alignments, using the moca routine. MOCA is
a routine that allows extracting all the local alignments that show some
similarity with another predefined fragment.
'mocca' is a
perl script that calls t-coffee and provides it with the appropriate
parameters.
-domain/-mocca
Usage:
-domain
Default: not set
This flag indicates that t_coffee will run using the domain mode. All the sequences will be concatenated, and the resulting sequence will be compared to itself using lalign_rs_s_pair mode (lalign of the sequence against itself using keeping the lalign raw score). This step is the most computer intensive, and it is advisable to save the resulting file.
PROMPT: t_coffee -in Ssample_seq1.fasta,Mlalign_rs_s_pair -out_lib=sample_lib1.mocca_lib -domain -start=100 -len=50
This instruction will use the fragment 100-150 on the concatenated sequences, as a template for the extracted repeats. The extraction will only be made once. The library will be placed in the file <lib name>.
If you want, you can test other coordinates for the repeat, such as
PROMPT: t_coffee -in sample_lib1.mocca_lib -domain -start=100 -len=60
This run will use the fragment 100-160, and will be much faster because it does not need to re-compute the lalign library.
Usage:
-start=<int value>
Default: not set
This flag indicates the starting position of the portion of sequence that will be used as a template for the repeat extraction. The value assumes that all the sequences have been concatenated, and is given on the resulting sequence.
Usage:
-len=<int value>
Default: not set
This flag indicates the length of the portion of sequence that will be used as a template.
Usage:
-scale=<int value>
Default: -scale=-100
This flag indicates the value of the threshold for extracting the repeats. The actual threshold is equal to:
motif_len*scale
Increase the scale óIncrease sensitivity ó More alignments( i.e. -50).
-domain_interactive [Examples]
Usage:
-domain_interactive
Default: unset
Launches an interactive mocca session.
PROMPT: t_coffee -in Lsample_lib3.tc_lib,Mlalign_rs_s_pair -domain -start=100 -len=60
TOLB_ECOLI_212_26 211 SKLAYVTFESGR--SALVIQTLANGAVRQV-ASFPRHNGAPAFSPDGSKLAFA
TOLB_ECOLI_165_218 164
TRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYV
TOLB_ECOLI_256_306 255
SKLAFALSKTGS--LNLYVMDLASGQIRQV-TDGRSNNTEPTWFPDSQNLAFT
TOLB_ECOLI_307_350 306
-------DQAGR--PQVYKVNINGGAPQRI-TWEGSQNQDADVSSDGKFMVMV
TOLB_ECOLI_351_393 350
-------SNGGQ--QHIAKQDLATGGV-QV-LSSTFLDETPSLAPNGTMVIYS
1 * * :
. .:.
:
MENU: Type Letter
Flag[number] and Return: ex |10
|x
-->Set the START to x
>x -->Set the LEN
to x
Cx -->Set the sCale to x
Sname -->Save
the Alignment
Bx -->Save Goes back x it
return -->Compute the Alignment
X -->eXit
[ITERATION 1] [START=211] [LEN=
50] [SCALE=-100] YOUR CHOICE:
For instance, to set the length of the domain to 40, type:
[ITERATION 1] [START=211] [LEN=
50] [SCALE=-100] YOUR
CHOICE:>40[return]
[return]
Which will generate:
TOLB_ECOLI_212_252 211
SKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAF
251
TOLB_ECOLI_256_296 255
SKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTW
295
TOLB_ECOLI_300_340 299
QNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADV
339
TOLB_ECOLI_344_383 343
KFMVMVSSNGGQQHIAKQDLATGGV-QVLSSTFLDETPSL
382
TOLB_ECOLI_387_427 386
TMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAW
426
1 :
: : :: .
40
MENU: Type Letter
Flag[number] and Return: ex |10
|x -->Set
the START to x
>x -->Set the LEN
to x
Cx -->Set the sCale to x
Sname -->Save
the Alignment
Bx -->Save Goes back x it
return -->Compute the Alignment
X -->eXit
[ITERATION 3] [START=211] [LEN=
40] [SCALE=-100] YOUR CHOICE:
If you want to indicate the coordinates, relative to a specific sequence, type:
|<seq_name>:start
Type S<your name> to save the current alignment, and extract a new motif.
Type X when you are done.
Conventions Regarding Filenames
stdout, stderr,
stdin, no, /dev/null are valid
filenames. They cause the corresponding file to be output in stderr or stdout,
for an input file, stdin causes the
program to requests the corresponding file through pipe. No causes a suppression of the output, as does /dev/null.
Identifying the Output files automatically
In the
t_coffee output, each output appears in a line:
#####
FILENAME <name> TYPE <Type> FORMAT <Format>
Usage: -no_warning
Default: Switched off
Suppresseswarning output.
Usage: -outfile=<out_aln file,default,no>
Default:-outfile=default
Indicates the name of the alignment
output by t_coffee. If the default is used, the alignment is named <your sequences>.aln
Usage: -output=<format1,format2,...>
Default:-output=clustalw
Indicates the format used for outputting the -outfile.
Supported formats are:
clustalw_aln, clustalw : ClustalW format.
gcg, msf_aln : MSF alignment.
pir_aln : pir alignment.
fasta_aln : fasta alignment.
phylip : Phylip format.
pir_seq : pir sequences (no gap).
fasta_seq : fasta sequences (no gap).
As well as:
score_ascii : causes the output of a reliability flag
score_html : causes the output to be a reliability plot in HTML
score_pdf : idem in PDF (if ps2pdf is installed on your system).
score_ps : idem in postscript.
More than one format can be indicated:
PROMPT: t_coffee sample_seq1.fasta -output=clustalw,gcg, score_html
A publication describing the CORE index is available on:
http://igs-server.cnrs-mrs.fr/~cnotred/Publications/Pdf/core.pp.pdf
Usage: -outseqweight=<filename>
Default: not used
Indicates the name of the file in which the sequences weights should be saved..
Usage: -case=<keep,upper,lower>
Default: -case=keep
Instructs
the program on the case to be used in the output file (Clustalw uses upper
case). The default keeps the case and makes it possible to maintain a mixture
of upper and lower case residues.
If you need
to change the case of your file, you can use seq_reformat:
PROMPT: t_coffee –other_pg seq_reformat –in sample_aln1.aln –action +lower –output clustalw
Usage: deprecated
Usage:
-outseqweight=<name of the file containing the weights applied>
Default:
-outseqweight=no
Will cause
the program to output the weights associated with every sequence in the
dataset.
Usage: -outorder=<input OR aligned OR
filename>
Default:-outorder=input
Sets the order of the sequences in the output alignment: -outorder=input means the sequences are kept in the original order. -outorder=aligned means the sequences come in the order indicated by the tree. This order can be seen as a one-dimensional projection of the tree distances. –outdorder=<filename>Filename is a legal fasta file, whose order will be used in the final alignment.
Usage: -inorder=<input OR aligned>
Default:-inorder=aligned
Multiple alignments based on dynamic programming depend slightly on the order in which the incoming sequences are provided. To prevent this effect sequences are arbitrarily sorted at the beginning of the program (-inorder=aligned). However, this affects the sequence order within the library. You can switch this off by ststing –inorder=input.
Usage: -seqnos=<on or off>
Default:-seqnos=off
Causes the
output alignment to contain residue numbers at the end of each line:
T-COFFEE
seq1
aaa---aaaa--------aa 9
seq2
a-----aa-----------a 4
seq1
a-----------------a 11
seq2
aaaaaaaaaaaaaaaaaaa 19
Although, it
does not necessarily do so explicitly, T-Coffee always end up combining
libraries. Libraries are collections of pairs of residues. Given a set of
libraries, T-Coffee makes an attempt to assemble the alignment with the highest
level of consistence. You can think of the alignment as a timetable. Each
library pair would be a request from students or teachers, and the job of
T-Coffee would be to assemble the time table that makes as many people as
possible happy…
Usage: -out_lib=<name of the
library,default,no>
Default:-out_lib=default
Sets the name of the library output. Default implies <run_name>.tc_lib
Usage: -lib_only
Default: unset
Causes the program to stop once the library has been computed. Must be used in conjunction with the flag –out_lib
Usage:
-newtree=<tree file>
Default: No file specified
Indicates the name of the file into
which the guide tree will be written. The default will be
<sequence_name>.dnd, or <run_name.dnd>. The tree is written in the
parenthesis format known as newick or
Do NOT confuse this guide tree with a phylogenetic tree.
The CORE is
an index that indicates the consistency between the library of piarwise
alignments and the final multiple alignment. Our experiment indicate that the
higher this consistency, the more reliable the alignment. A publication
describing the CORE index can be found on:
http://igs-server.cnrs-mrs.fr/~cnotred/Publications/Pdf/core.pp.pdf
Usage:
-evaluate_mode=<t_coffee_fast,t_coffee_slow,t_coffee_non_extended >
Default: -evaluate_mode=t_coffee_fast
This flag indicates the mode used to normalize the t_coffee score when computing the reliability score.
t_coffee_fast: Normalization is made using the highest score in the MSA. This evaluation mode was validated and in our hands, pairs of residues with a score of 5 or higher have 90 % chances to be correctly aligned to one another.
t_coffee_slow: Normalization is made using the library. This usually results in lower score and a scoring scheme more sensitive to the number of sequences in the dataset. Note that this scoring scheme is not any more slower, thanks to the implementation of a faster heuristic algorithm.
t_coffee_non_extended: the score of each residue is the ratio between the sum of its non extended scores with the column and the sum of all its possible non extended scores.
These modes will be useful when generating colored version of the output, with the –output flag:
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_slow –output score_ascii, score_html
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_fast –output score_ascii, score_html
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_non_extended –output score_ascii, score_html
Usage:
-run_name=<your run name>
Default: no default set
This flag
causes the prefix <your sequences>
to be replaced by <your run name>
when renaming the default output files.
Usage:
-quiet=<stderr,stdout,file name OR nothing>.
Default:-quiet=stderr
Redirects the standard output to either a file. -quiet on its own redirect the output to /dev/null.
This flag
indicates that the program must produce the alignment. It is here for
compatibility with ClustalW.
Warning: These flags will only work within the APDB package that can be invoked via the –other_pg parameter of T-Coffee:
t_coffee –other_pg apdb –aln <your aln>
Usage:
-aln=<file_name>.
Default:none
Indicates the name of the file containing the sequences that need to be evaluated. The sequences whose structure is meant to be used must be named according to their PDB identifier.
The format can be FASTA, CLUSTAL or any of the formats supported by T-Coffee. APDB only evaluates residues in capital and ignores those in lower case. If your sequences are in lower case, you can upper case them using seq_reformat:
PROMPT: t_coffee –other_pg seq_reformat –in 3d_sample4.aln –action +upper –output clustalw > 3d_sample4.cw_aln
The alignment can then be evaluated using the defaultr of APDB:
PROMPT: t_coffee –other_pg apdb –aln 3d_sample4.aln
The alignment can contain as many structures as you wish.
Usage:
-n_excluded_nb=<integer>.
Default:1
When evaluating the local score of a pair of aligned residues, the residues immediately next to that column should not contribute to the measure. By default the first to the left and first to the right are iple alignments based on dynamic programming depend slightly on the order in which the incoming sequences are provided. To prevent this effect sequences are arbitrarily sorted at the beginning of the program (-inorder=aligned). However, this affects the sequence order within the library. You can switch this off by ststing –inorder=input.
Usage: -seqnos=<on or off>
Default:-seqnos=off
Causes the
output alignment to contain residue numbers at the end of each line:
T-COFFEE
seq1
aaa---aaaa--------aa 9
seq2
a-----aa-----------a 4
seq1
a-----------------a 11
seq2
aaaaaaaaaaaaaaaaaaa 19
Although, it
does not necessarily do so explicitly, T-Coffee always end up combining
libraries. Libraries are collections of pairs of residues. Given a set of
libraries, T-Coffee makes an attempt to assemble the alignment with the highest
level of consistence. You can think of the alignment as a timetable. Each
library pair would be a request from students or teachers, and the job of
T-Coffee would be to assemble the time table that makes as many people as
possible happy…
Usage: -out_lib=<name of the
library,default,no>
Default:-out_lib=default
Sets the name of the library output. Default implies <run_name>.tc_lib
Usage: -lib_only
Default: unset
Causes the program to stop once the library has been computed. Must be used in conjunction with the flag –out_lib
Usage:
-newtree=<tree file>
Default: No file specified
Indicates the name of the file into
which the guide tree will be written. The default will be
<sequence_name>.dnd, or <run_name.dnd>. The tree is written in the
parenthesis format known as newick or
Do NOT confuse this guide tree with a phylogenetic tree.
The CORE is
an index that indicates the consistency between the library of piarwise
alignments and the final multiple alignment. Our experiment indicate that the
higher this consistency, the more reliable the alignment. A publication
describing the CORE index can be found on:
http://igs-server.cnrs-mrs.fr/~cnotred/Publications/Pdf/core.pp.pdf
Usage:
-evaluate_mode=<t_coffee_fast,t_coffee_slow,t_coffee_non_extended >
Default: -evaluate_mode=t_coffee_fast
This flag indicates the mode used to normalize the t_coffee score when computing the reliability score.
t_coffee_fast: Normalization is made using the highest score in the MSA. This evaluation mode was validated and in our hands, pairs of residues with a score of 5 or higher have 90 % chances to be correctly aligned to one another.
t_coffee_slow: Normalization is made using the library. This usually results in lower score and a scoring scheme more sensitive to the number of sequences in the dataset. Note that this scoring scheme is not any more slower, thanks to the implementation of a faster heuristic algorithm.
t_coffee_non_extended: the score of each residue is the ratio between the sum of its non extended scores with the column and the sum of all its possible non extended scores.
These modes will be useful when generating colored version of the output, with the –output flag:
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_slow –output score_ascii, score_html
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_fast –output score_ascii, score_html
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_non_extended –output score_ascii, score_html
Usage:
-run_name=<your run name>
Default: no default set
This flag
causes the prefix <your sequences>
to be replaced by <your run name>
when renaming the default output files.
Usage:
-quiet=<stderr,stdout,file name OR nothing>.
Default:-quiet=stderr
Redirects the standard output to either a file. -quiet on its own redirect the output to /dev/null.
This flag
indicates that the program must produce the alignment. It is here for
compatibility with ClustalW.
Warning: These flags will only work within the APDB package that can be invoked via the –other_pg parameter of T-Coffee:
t_coffee –other_pg apdb –aln <your aln>
Usage:
-aln=<file_name>.
Default:none
Indicates the name of the file containing the sequences that need to be evaluated. The sequences whose structure is meant to be used must be named according to their PDB identifier.
The format can be FASTA, CLUSTAL or any of the formats supported by T-Coffee. APDB only evaluates residues in capital and ignores those in lower case. If your sequences are in lower case, you can upper case them using seq_reformat:
PROMPT: t_coffee –other_pg seq_reformat –in 3d_sample4.aln –action +upper –output clustalw > 3d_sample4.cw_aln
The alignment can then be evaluated using the defaultr of APDB:
PROMPT: t_coffee –other_pg apdb –aln 3d_sample4.aln
The alignment can contain as many structures as you wish.
Usage:
-n_excluded_nb=<integer>.
Default:1
When evaluating the local score of a pair of aligned residues, the residues immediately next to that column should not contribute to the measure. By default the first to the left and first to the right are iple alignments based on dynamic programming depend slightly on the order in which the incoming sequences are provided. To prevent this effect sequences are arbitrarily sorted at the beginning of the program (-inorder=aligned). However, this affects the sequence order within the library. You can switch this off by ststing –inorder=input.
Usage: -seqnos=<on or off>
Default:-seqnos=off
Causes the
output alignment to contain residue numbers at the end of each line:
T-COFFEE
seq1
aaa---aaaa--------aa 9
seq2
a-----aa-----------a 4
seq1
a-----------------a 11
seq2
aaaaaaaaaaaaaaaaaaa 19
Although, it
does not necessarily do so explicitly, T-Coffee always end up combining
libraries. Libraries are collections of pairs of residues. Given a set of
libraries, T-Coffee makes an attempt to assemble the alignment with the highest
level of consistence. You can think of the alignment as a timetable. Each
library pair would be a request from students or teachers, and the job of
T-Coffee would be to assemble the time table that makes as many people as
possible happy…
Usage: -out_lib=<name of the
library,default,no>
Default:-out_lib=default
Sets the name of the library output. Default implies <run_name>.tc_lib
Usage: -lib_only
Default: unset
Causes the program to stop once the library has been computed. Must be used in conjunction with the flag –out_lib
Usage:
-newtree=<tree file>
Default: No file specified
Indicates the name of the file into
which the guide tree will be written. The default will be
<sequence_name>.dnd, or <run_name.dnd>. The tree is written in the
parenthesis format known as newick or
Do NOT confuse this guide tree with a phylogenetic tree.
The CORE is
an index that indicates the consistency between the library of piarwise
alignments and the final multiple alignment. Our experiment indicate that the
higher this consistency, the more reliable the alignment. A publication
describing the CORE index can be found on:
http://igs-server.cnrs-mrs.fr/~cnotred/Publications/Pdf/core.pp.pdf
Usage:
-evaluate_mode=<t_coffee_fast,t_coffee_slow,t_coffee_non_extended >
Default: -evaluate_mode=t_coffee_fast
This flag indicates the mode used to normalize the t_coffee score when computing the reliability score.
t_coffee_fast: Normalization is made using the highest score in the MSA. This evaluation mode was validated and in our hands, pairs of residues with a score of 5 or higher have 90 % chances to be correctly aligned to one another.
t_coffee_slow: Normalization is made using the library. This usually results in lower score and a scoring scheme more sensitive to the number of sequences in the dataset. Note that this scoring scheme is not any more slower, thanks to the implementation of a faster heuristic algorithm.
t_coffee_non_extended: the score of each residue is the ratio between the sum of its non extended scores with the column and the sum of all its possible non extended scores.
These modes will be useful when generating colored version of the output, with the –output flag:
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_slow –output score_ascii, score_html
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_fast –output score_ascii, score_html
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_non_extended –output score_ascii, score_html
Usage:
-run_name=<your run name>
Default: no default set
This flag
causes the prefix <your sequences>
to be replaced by <your run name>
when renaming the default output files.
Usage:
-quiet=<stderr,stdout,file name OR nothing>.
Default:-quiet=stderr
Redirects the standard output to either a file. -quiet on its own redirect the output to /dev/null.
This flag
indicates that the program must produce the alignment. It is here for
compatibility with ClustalW.
Warning: These flags will only work within the APDB package that can be invoked via the –other_pg parameter of T-Coffee:
t_coffee –other_pg apdb –aln <your aln>
Usage:
-aln=<file_name>.
Default:none
Indicates the name of the file containing the sequences that need to be evaluated. The sequences whose structure is meant to be used must be named according to their PDB identifier.
The format can be FASTA, CLUSTAL or any of the formats supported by T-Coffee. APDB only evaluates residues in capital and ignores those in lower case. If your sequences are in lower case, you can upper case them using seq_reformat:
PROMPT: t_coffee –other_pg seq_reformat –in 3d_sample4.aln –action +upper –output clustalw > 3d_sample4.cw_aln
The alignment can then be evaluated using the defaultr of APDB:
PROMPT: t_coffee –other_pg apdb –aln 3d_sample4.aln
The alignment can contain as many structures as you wish.
Usage:
-n_excluded_nb=<integer>.
Default:1
When evaluating the local score of a pair of aligned residues, the residues immediately next to that column should not contribute to the measure. By default the first to the left and first to the right are iple alignments based on dynamic programming depend slightly on the order in which the incoming sequences are provided. To prevent this effect sequences are arbitrarily sorted at the beginning of the program (-inorder=aligned). However, this affects the sequence order within the library. You can switch this off by ststing –inorder=input.
Usage: -seqnos=<on or off>
Default:-seqnos=off
Causes the
output alignment to contain residue numbers at the end of each line:
T-COFFEE
seq1
aaa---aaaa--------aa 9
seq2
a-----aa-----------a 4
seq1
a-----------------a 11
seq2
aaaaaaaaaaaaaaaaaaa 19
Although, it
does not necessarily do so explicitly, T-Coffee always end up combining
libraries. Libraries are collections of pairs of residues. Given a set of
libraries, T-Coffee makes an attempt to assemble the alignment with the highest
level of consistence. You can think of the alignment as a timetable. Each
library pair would be a request from students or teachers, and the job of
T-Coffee would be to assemble the time table that makes as many people as
possible happy…
Usage: -out_lib=<name of the
library,default,no>
Default:-out_lib=default
Sets the name of the library output. Default implies <run_name>.tc_lib
Usage: -lib_only
Default: unset
Causes the program to stop once the library has been computed. Must be used in conjunction with the flag –out_lib
Usage:
-newtree=<tree file>
Default: No file specified
Indicates the name of the file into
which the guide tree will be written. The default will be
<sequence_name>.dnd, or <run_name.dnd>. The tree is written in the
parenthesis format known as newick or
Do NOT confuse this guide tree with a phylogenetic tree.
The CORE is
an index that indicates the consistency between the library of piarwise
alignments and the final multiple alignment. Our experiment indicate that the
higher this consistency, the more reliable the alignment. A publication
describing the CORE index can be found on:
http://igs-server.cnrs-mrs.fr/~cnotred/Publications/Pdf/core.pp.pdf
Usage:
-evaluate_mode=<t_coffee_fast,t_coffee_slow,t_coffee_non_extended >
Default: -evaluate_mode=t_coffee_fast
This flag indicates the mode used to normalize the t_coffee score when computing the reliability score.
t_coffee_fast: Normalization is made using the highest score in the MSA. This evaluation mode was validated and in our hands, pairs of residues with a score of 5 or higher have 90 % chances to be correctly aligned to one another.
t_coffee_slow: Normalization is made using the library. This usually results in lower score and a scoring scheme more sensitive to the number of sequences in the dataset. Note that this scoring scheme is not any more slower, thanks to the implementation of a faster heuristic algorithm.
t_coffee_non_extended: the score of each residue is the ratio between the sum of its non extended scores with the column and the sum of all its possible non extended scores.
These modes will be useful when generating colored version of the output, with the –output flag:
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_slow –output score_ascii, score_html
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_fast –output score_ascii, score_html
PROMPT: t_coffee sample_seq1.fasta –evaluate_mode t_coffee_non_extended –output score_ascii, score_html
Usage:
-run_name=<your run name>
Default: no default set
This flag
causes the prefix <your sequences>
to be replaced by <your run name>
when renaming the default output files.
Usage:
-quiet=<stderr,stdout,file name OR nothing>.
Default:-quiet=stderr
Redirects the standard output to either a file. -quiet on its own redirect the output to /dev/null.
This flag
indicates that the program must produce the alignment. It is here for
compatibility with ClustalW.
Warning: These flags will only work within the APDB package that can be invoked via the –other_pg parameter of T-Coffee:
t_coffee –other_pg apdb –aln <your aln>
Usage:
-aln=<file_name>.
Default:none
Indicates the name of the file containing the sequences that need to be evaluated. The sequences whose structure is meant to be used must be named according to their PDB identifier.
The format can be FASTA, CLUSTAL or any of the formats supported by T-Coffee. APDB only evaluates residues in capital and ignores those in lower case. If your sequences are in lower case, you can upper case them using seq_reformat:
PROMPT: t_coffee –other_pg seq_reformat –in 3d_sample4.aln –action +upper –output clustalw > 3d_sample4.cw_aln
The alignment can then be evaluated using the defaultr of APDB:
PROMPT: t_coffee –other_pg apdb –aln 3d_sample4.aln
The alignment can contain as many structures as you wish.
Usage:
-n_excluded_nb=<integer>.
Default:1
When evaluating the local score of a pair of aligned residues, the residues immediately next to that column should not contribute to the measure. By default the first to the left and first to the right are iple alignments based on dynamic programming depend slightly on the order in which the incoming sequences are provided. To prevent this effect sequences are arbitrarily sorted at the beginning of the program (-inorder=aligned). However, this affects the sequence order within the library. You can switch this off by ststing –inorder=input.
Usage: -seqnos=<on or off>
Default:-seqnos=off
Causes the
output alignment to contain residue numbers at the end of each line:
T-COFFEE
seq1
aaa---aaaa--------aa 9
seq2
a-----aa-----------a 4
seq1
a-----------------a 11
seq2
aaaaaaaaaaaaaaaaaaa 19
Although, it
does not necessarily do so explicitly, T-Coffee always end up combining
libraries. Libraries are collections of pairs of residues. Given a set of
libraries, T-Coffee makes an attempt to assemble the alignment with the highest
level of consistence. You can think of the alignment as a timetable. Each
library pair would be a request from students or teachers, and the job of
T-Coffee would be to assemble the time table that makes as many people as
possible happy…
Usage: -out_lib=<name of the
library,default,no>
Default:-out_lib=default
Sets the name of the library output. Default implies <run_name>.tc_lib
Usage: -lib_only
Default: unset
Causes the program to stop once the library has been computed. Must be used in conjunction with the flag –out_lib